Lineage for d1iujb_ (1iuj B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. Family d.58.4.5: PG130-like [102959] (6 proteins)
    subfamily of Pfam PF03992
  6. Protein Hypothetical protein TT1380 [102960] (1 species)
  7. Species Thermus thermophilus [TaxId:274] [102961] (1 PDB entry)
  8. Domain d1iujb_: 1iuj B: [90702]
    structural genomics
    complexed with zn

Details for d1iujb_

PDB Entry: 1iuj (more details), 1.6 Å

PDB Description: The structure of TT1380 protein from thermus thermophilus
PDB Compounds: (B:) hypothetical protein TT1380

SCOPe Domain Sequences for d1iujb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iujb_ d.58.4.5 (B:) Hypothetical protein TT1380 {Thermus thermophilus [TaxId: 274]}
mfvtmnripvrpeyaeqfeeafrqrarlvdrmpgfirnlvlrpknpgdpyvvmtlwesee
afrawtespafkegharsgtlpkeaflgpnrleafevvldseg

SCOPe Domain Coordinates for d1iujb_ are not available.

Timeline for d1iujb_:

Domains from other chains:
(mouse over for more information)
d1iuja_