SCOPe 2.08: Domain d1iujb_: 1iuj B:

Lineage for d1iujb_ (1iuj B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.5: PG130-like [102959] (6 proteins)
   subfamily of Pfam PF03992

6. Protein Hypothetical protein TT1380 [102960] (1 species)

7. Species Thermus thermophilus [TaxId:274] [102961] (1 PDB entry)

8. Domain d1iujb_: 1iuj B: [90702]
   structural genomics
   complexed with zn

Details for d1iujb_

PDB Entry: 1iuj, 1.6 Å

PDB Description: The structure of TT1380 protein from thermus thermophilus

PDB Compounds: (B:) hypothetical protein TT1380

SCOPe Domain Sequences for d1iujb_:

Sequence; same for both SEQRES and ATOM records:

>d1iujb_ d.58.4.5 (B:) Hypothetical protein TT1380 {Thermus thermophilus [TaxId: 274]}
mfvtmnripvrpeyaeqfeeafrqrarlvdrmpgfirnlvlrpknpgdpyvvmtlwesee
afrawtespafkegharsgtlpkeaflgpnrleafevvldseg

Timeline for d1iujb_:

• d1iujb_ first appeared in SCOP 1.67
  
• d1iujb_ appears in SCOPe 2.07