Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.67: PLP-dependent transferases [53382] (1 superfamily) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) |
Family c.67.1.3: Cystathionine synthase-like [53402] (14 proteins) |
Protein Subgroup IV putative aspartate aminotransferase [102599] (1 species) |
Species Thermus thermophilus [TaxId:274] [102600] (1 PDB entry) |
Domain d1iugb_: 1iug B: [90700] complexed with po4 |
PDB Entry: 1iug (more details), 2.2 Å
SCOP Domain Sequences for d1iugb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iugb_ c.67.1.3 (B:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus} dwlltpgpvrlhpkalealarpqlhhrteaarevflkargllreafrtegevliltgsgt lamealvknlfapgervlvpvygkfserfyeialeaglvverldypygdtprpedvakeg yaglllvhsetstgaladlpalarafkeknpeglvgadmvtsllvgevaleamgvdaaas gsqkglmcppglgfvalspralerlkprgyyldlarelkaqkegesawtpainlvlavaa vleevlprleehlalkawqnallygvgeegglrpvpkrfspavaafylpegvpyarvkea faqrgaviaggqgplkgkvfrlslmgaydryealgvagmfrevleeil
Timeline for d1iugb_: