Lineage for d1iugb_ (1iug B:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 589118Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 589119Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 589415Family c.67.1.3: Cystathionine synthase-like [53402] (14 proteins)
  6. 589577Protein Subgroup IV putative aspartate aminotransferase [102599] (1 species)
  7. 589578Species Thermus thermophilus [TaxId:274] [102600] (1 PDB entry)
  8. 589580Domain d1iugb_: 1iug B: [90700]
    complexed with po4

Details for d1iugb_

PDB Entry: 1iug (more details), 2.2 Å

PDB Description: The crystal structure of aspartate aminotransferase which belongs to subgroup IV from Thermus thermophilus

SCOP Domain Sequences for d1iugb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iugb_ c.67.1.3 (B:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus}
dwlltpgpvrlhpkalealarpqlhhrteaarevflkargllreafrtegevliltgsgt
lamealvknlfapgervlvpvygkfserfyeialeaglvverldypygdtprpedvakeg
yaglllvhsetstgaladlpalarafkeknpeglvgadmvtsllvgevaleamgvdaaas
gsqkglmcppglgfvalspralerlkprgyyldlarelkaqkegesawtpainlvlavaa
vleevlprleehlalkawqnallygvgeegglrpvpkrfspavaafylpegvpyarvkea
faqrgaviaggqgplkgkvfrlslmgaydryealgvagmfrevleeil

SCOP Domain Coordinates for d1iugb_:

Click to download the PDB-style file with coordinates for d1iugb_.
(The format of our PDB-style files is described here.)

Timeline for d1iugb_: