SCOP 1.67: Domain d1iugb_: 1iug B:

Lineage for d1iugb_ (1iug B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (6 families)

5. Family c.67.1.3: Cystathionine synthase-like [53402] (13 proteins)

6. Protein Subgroup IV putative aspartate aminotransferase [102599] (1 species)

7. Species Thermus thermophilus [TaxId:274] [102600] (1 PDB entry)

8. Domain d1iugb_: 1iug B: [90700]
   complexed with po4

Details for d1iugb_

PDB Entry: 1iug, 2.2 Å

PDB Description: The crystal structure of aspartate aminotransferase which belongs to subgroup IV from Thermus thermophilus

SCOP Domain Sequences for d1iugb_:

Sequence; same for both SEQRES and ATOM records:

>d1iugb_ c.67.1.3 (B:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus}
dwlltpgpvrlhpkalealarpqlhhrteaarevflkargllreafrtegevliltgsgt
lamealvknlfapgervlvpvygkfserfyeialeaglvverldypygdtprpedvakeg
yaglllvhsetstgaladlpalarafkeknpeglvgadmvtsllvgevaleamgvdaaas
gsqkglmcppglgfvalspralerlkprgyyldlarelkaqkegesawtpainlvlavaa
vleevlprleehlalkawqnallygvgeegglrpvpkrfspavaafylpegvpyarvkea
faqrgaviaggqgplkgkvfrlslmgaydryealgvagmfrevleeil

Timeline for d1iugb_:

• d1iugb_ is new in SCOP 1.67
  
• d1iugb_ appears in SCOP 1.69
  
• d1iugb_ appears in the current release, SCOPe 2.08