SCOPe 2.08: Domain d1iuga_: 1iug A:

Lineage for d1iuga_ (1iug A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.3: Cystathionine synthase-like [53402] (17 proteins)

6. Protein Subgroup IV putative aspartate aminotransferase [102599] (1 species)

7. Species Thermus thermophilus [TaxId:274] [102600] (1 PDB entry)

8. Domain d1iuga_: 1iug A: [90699]
   complexed with po4

Details for d1iuga_

PDB Entry: 1iug, 2.2 Å

PDB Description: The crystal structure of aspartate aminotransferase which belongs to subgroup IV from Thermus thermophilus

PDB Compounds: (A:) putative aspartate aminotransferase

SCOPe Domain Sequences for d1iuga_:

Sequence; same for both SEQRES and ATOM records:

>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]}
dwlltpgpvrlhpkalealarpqlhhrteaarevflkargllreafrtegevliltgsgt
lamealvknlfapgervlvpvygkfserfyeialeaglvverldypygdtprpedvakeg
yaglllvhsetstgaladlpalarafkeknpeglvgadmvtsllvgevaleamgvdaaas
gsqkglmcppglgfvalspralerlkprgyyldlarelkaqkegesawtpainlvlavaa
vleevlprleehlalkawqnallygvgeegglrpvpkrfspavaafylpegvpyarvkea
faqrgaviaggqgplkgkvfrlslmgaydryealgvagmfrevleeil

Timeline for d1iuga_:

• d1iuga_ first appeared in SCOP 1.67
  
• d1iuga_ appears in SCOPe 2.07