Lineage for d1iuca_ (1iuc A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802176Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1802927Superfamily b.68.8: Fucose-specific lectin [89372] (2 families) (S)
    automatically mapped to Pfam PF07938
  5. 1802928Family b.68.8.1: Fucose-specific lectin [89373] (1 protein)
  6. 1802929Protein Fucose-specific lectin [89374] (1 species)
  7. 1802930Species Orange peel mushroom (Aleuria aurantia) [TaxId:5188] [89375] (3 PDB entries)
  8. 1802933Domain d1iuca_: 1iuc A: [90696]
    complexed with fuc, ful, so4

Details for d1iuca_

PDB Entry: 1iuc (more details), 2.24 Å

PDB Description: fucose-specific lectin from aleuria aurantia with three ligands
PDB Compounds: (A:) fucose-specific lectin

SCOPe Domain Sequences for d1iuca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iuca_ b.68.8.1 (A:) Fucose-specific lectin {Orange peel mushroom (Aleuria aurantia) [TaxId: 5188]}
pteflytskiaaiswaatggrqqrvyfqdlngkireaqrggdnpwtggssqnvigeaklf
splaavtwksaqgiqirvycvnkdnilsefvydgskwitgqlgsvgvkvgsnsklaalqw
ggsesappnirvyyqksngsgssiheyvwsgkwtagasfgstvpgtgigataigpgrlri
yyqatdnkirehcwdsnswyvggfsasasagvsiaaiswgstpnirvywqkgreelyeaa
yggswntpgqikdasrptpslpdtfiaanssgnidisvffqasgvslqqwqwisgkgwsi
gavvptgtpagw

SCOPe Domain Coordinates for d1iuca_:

Click to download the PDB-style file with coordinates for d1iuca_.
(The format of our PDB-style files is described here.)

Timeline for d1iuca_: