Lineage for d1iuba_ (1iub A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064980Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2065738Superfamily b.68.8: Fucose-specific lectin [89372] (2 families) (S)
    automatically mapped to Pfam PF07938
  5. 2065739Family b.68.8.1: Fucose-specific lectin [89373] (1 protein)
  6. 2065740Protein Fucose-specific lectin [89374] (1 species)
  7. 2065741Species Orange peel mushroom (Aleuria aurantia) [TaxId:5188] [89375] (3 PDB entries)
  8. 2065745Domain d1iuba_: 1iub A: [90695]
    complexed with cl, ful, hg, so4

Details for d1iuba_

PDB Entry: 1iub (more details), 2.31 Å

PDB Description: Fucose-specific lectin from Aleuria aurantia (Hg-derivative form)
PDB Compounds: (A:) fucose-specific lectin

SCOPe Domain Sequences for d1iuba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iuba_ b.68.8.1 (A:) Fucose-specific lectin {Orange peel mushroom (Aleuria aurantia) [TaxId: 5188]}
pteflytskiaaiswaatggrqqrvyfqdlngkireaqrggdnpwtggssqnvigeaklf
splaavtwksaqgiqirvycvnkdnilsefvydgskwitgqlgsvgvkvgsnsklaalqw
ggsesappnirvyyqksngsgssiheyvwsgkwtagasfgstvpgtgigataigpgrlri
yyqatdnkirehcwdsnswyvggfsasasagvsiaaiswgstpnirvywqkgreelyeaa
yggswntpgqikdasrptpslpdtfiaanssgnidisvffqasgvslqqwqwisgkgwsi
gavvptgtpagw

SCOPe Domain Coordinates for d1iuba_:

Click to download the PDB-style file with coordinates for d1iuba_.
(The format of our PDB-style files is described here.)

Timeline for d1iuba_: