Lineage for d1ista_ (1ist A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416159Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2416160Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2416161Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2416162Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 2416165Species Baker's yeast (Saccharomyces cerevisiae), variant A [TaxId:4932] [101878] (1 PDB entry)
    3jb9 chain d is cyclophilin from fission yeast; not included because sids are not case sensitive
  8. 2416166Domain d1ista_: 1ist A: [90692]

Details for d1ista_

PDB Entry: 1ist (more details), 1.9 Å

PDB Description: crystal structure of yeast cyclophilin a, cpr1
PDB Compounds: (A:) cyclophilin a

SCOPe Domain Sequences for d1ista_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ista_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Baker's yeast (Saccharomyces cerevisiae), variant A [TaxId: 4932]}
sqvyfdveadgqpigrvvfklyndivpktaenfralctgekgfgyagspfhrvipdfmlq
ggdftagngtggksiyggkfpdenfkkhhdrpgllsmanagpntngsqffittvpcpwld
gkhvvfgevvdgydivkkveslgspsgatkarivvaksgel

SCOPe Domain Coordinates for d1ista_:

Click to download the PDB-style file with coordinates for d1ista_.
(The format of our PDB-style files is described here.)

Timeline for d1ista_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1istb_