Class b: All beta proteins [48724] (144 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins) |
Protein Coagulation factor Xa, protease domain [50574] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50575] (35 PDB entries) |
Domain d1iqja_: 1iqj A: [90680] Other proteins in same PDB: d1iqjl_ |
PDB Entry: 1iqj (more details), 3 Å
SCOP Domain Sequences for d1iqja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iqja_ b.47.1.2 (A:) Coagulation factor Xa, protease domain {Human (Homo sapiens)} ivggqeckdgecpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaclperdwaestlm tqktgivsgfgrthekgrqstrlkmlevpyvdrnscklsssfiitqnmfcagydtkqeda cqgdsggphvtrfkdtyfvtgivswgegcarkgkygiytkvtaflkwidrsmktr
Timeline for d1iqja_: