Lineage for d1ihdc_ (1ihd C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142620Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2142621Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2142622Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 protein domains)
    automatically mapped to Pfam PF00710
  6. 2142623Protein Asparaginase type II [53776] (5 species)
  7. 2142653Species Escherichia coli [TaxId:562] [53777] (7 PDB entries)
  8. 2142675Domain d1ihdc_: 1ihd C: [90666]
    mutant

Details for d1ihdc_

PDB Entry: 1ihd (more details), 2.65 Å

PDB Description: crystal structure of trigonal form of d90e mutant of escherichia coli asparaginase ii
PDB Compounds: (C:) l-asparaginase II

SCOPe Domain Sequences for d1ihdc_:

Sequence, based on SEQRES records: (download)

>d1ihdc_ c.88.1.1 (C:) Asparaginase type II {Escherichia coli [TaxId: 562]}
lpnitilatggtiagggdsatksnytvgkvgvenlvnavpqlkdianvkgeqvvnigsqd
mndnvwltlakkintdcdktdgfvithgtetmeetayfldltvkcdkpvvmvgamrpsts
msadgpfnlynavvtaadkasanrgvlvvmndtvldgrdvtktnttdvatfksvnygplg
yihngkidyqrtparkhtsdtpfdvsklnelpkvgivynyanasdlpakalvdagydgiv
sagvgngnlyksvfdtlataaktgtavvrssrvptgattqdaevddakygfvasgtlnpq
karvllqlaltqtkdpqqiqqifnqy

Sequence, based on observed residues (ATOM records): (download)

>d1ihdc_ c.88.1.1 (C:) Asparaginase type II {Escherichia coli [TaxId: 562]}
lpnitilatggtiagnlvnavpqlkdianvkgeqvvnigsqdmndnvwltlakkintdcd
ktdgfvithgtetmeetayfldltvkcdkpvvmvgamrpstsmsadgpfnlynavvtaad
kasanrgvlvvmndtvldgrdvtktnttdvatfksvnygplgyihngkidyqrtparkht
sdtpfdvsklnelpkvgivynyanasdlpakalvdagydgivsagvgngnlyksvfdtla
taaktgtavvrssrvptgattqdaevddakygfvasgtlnpqkarvllqlaltqtkdpqq
iqqifnqy

SCOPe Domain Coordinates for d1ihdc_:

Click to download the PDB-style file with coordinates for d1ihdc_.
(The format of our PDB-style files is described here.)

Timeline for d1ihdc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ihda_