SCOPe 2.05: Domain d1hqqd_: 1hqq D:

Lineage for d1hqqd_ (1hqq D:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (124 PDB entries)

8. Domain d1hqqd_: 1hqq D: [90658]
   complexed with miniprotein MP-2, chains E, F, G and H

Details for d1hqqd_

PDB Entry: 1hqq, 1.7 Å

PDB Description: miniprotein mp-2 (m9a) complex with streptavidin

PDB Compounds: (D:) streptavidin

SCOPe Domain Sequences for d1hqqd_:

Sequence; same for both SEQRES and ATOM records:

>d1hqqd_ b.61.1.1 (D:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtalgw
tvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkvk

Timeline for d1hqqd_:

• d1hqqd_ first appeared in SCOP 1.67
  
• d1hqqd_ appears in SCOPe 2.04
  
• d1hqqd_ appears in SCOPe 2.06
  
• d1hqqd_ appears in the current release, SCOPe 2.08