Lineage for d1hlya_ (1hly A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2634700Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2635214Superfamily g.3.7: Scorpion toxin-like [57095] (6 families) (S)
  5. 2635336Family g.3.7.2: Short-chain scorpion toxins [57116] (35 proteins)
  6. 2635391Protein Hongotoxin 1 [103548] (1 species)
  7. 2635392Species Scorpion (Centruroides margaritatus) [TaxId:29018] [103549] (1 PDB entry)
  8. 2635393Domain d1hlya_: 1hly A: [90654]

Details for d1hlya_

PDB Entry: 1hly (more details)

PDB Description: solution structure of hongotoxin 1
PDB Compounds: (A:) hongotoxin 1

SCOPe Domain Sequences for d1hlya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hlya_ g.3.7.2 (A:) Hongotoxin 1 {Scorpion (Centruroides margaritatus) [TaxId: 29018]}
tvidvkctspkqclppckaqfgiragakcmngkckcyph

SCOPe Domain Coordinates for d1hlya_:

Click to download the PDB-style file with coordinates for d1hlya_.
(The format of our PDB-style files is described here.)

Timeline for d1hlya_: