Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.3: Putative alpha-L-fucosidase C-terminal domain [101928] (1 protein) glycosyl hydrolase family 29; beta-sheet forms a closed beta-barrel (n=8, S=10) |
Protein Putative alpha-L-fucosidase C-terminal domain [101929] (1 species) |
Species Thermotoga maritima [TaxId:2336] [101930] (3 PDB entries) TM0306 |
Domain d1hl9a1: 1hl9 A:357-448 [90650] Other proteins in same PDB: d1hl9a2, d1hl9b2 complexed with fuf |
PDB Entry: 1hl9 (more details), 2.25 Å
SCOPe Domain Sequences for d1hl9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hl9a1 b.71.1.3 (A:357-448) Putative alpha-L-fucosidase C-terminal domain {Thermotoga maritima [TaxId: 2336]} gtsvwerccaktedgteirftrkcnrifviflgiptgekiviedlnlsagtvrhfltger lsfknvgknleitvpkklletdsitlvleave
Timeline for d1hl9a1: