Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (30 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.12: Haloperoxidase [53531] (6 proteins) |
Protein Gamma-lactamase [102627] (1 species) haloperoxidase homologue |
Species Aureobacterium sp. [TaxId:51671] [102628] (2 PDB entries) |
Domain d1hl7b_: 1hl7 B: [90645] complexed with bd1 |
PDB Entry: 1hl7 (more details), 1.73 Å
SCOP Domain Sequences for d1hl7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hl7b_ c.69.1.12 (B:) Gamma-lactamase {Aureobacterium sp.} gyitvgnenstpielyyedqgsgqpvvlihgypldghswerqtrellaqgyrvitydrrg fggsskvntgydydtfaadlhtvletldlrdvvlvgfsmgtgelaryvaryghervakla flaslepflvqrddnpegvpqevfdgieaaakgdrfawftdfyknfynldenlgsriseq avtgswnvaigsapvaayavvpawiedfrsdveavraagkptlilhgtkdnilpidatar rfhqavpeadyvevegaphgllwthadevnaalktflak
Timeline for d1hl7b_: