Lineage for d1hl7b_ (1hl7 B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 400671Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 400672Superfamily c.69.1: alpha/beta-Hydrolases [53474] (30 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 400971Family c.69.1.12: Haloperoxidase [53531] (6 proteins)
  6. 400994Protein Gamma-lactamase [102627] (1 species)
    haloperoxidase homologue
  7. 400995Species Aureobacterium sp. [TaxId:51671] [102628] (2 PDB entries)
  8. 400999Domain d1hl7b_: 1hl7 B: [90645]
    complexed with bd1

Details for d1hl7b_

PDB Entry: 1hl7 (more details), 1.73 Å

PDB Description: gamma lactamase from an aureobacterium species in complex with 3a,4,7, 7a-tetrahydro-benzo [1,3] dioxol-2-one

SCOP Domain Sequences for d1hl7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hl7b_ c.69.1.12 (B:) Gamma-lactamase {Aureobacterium sp.}
gyitvgnenstpielyyedqgsgqpvvlihgypldghswerqtrellaqgyrvitydrrg
fggsskvntgydydtfaadlhtvletldlrdvvlvgfsmgtgelaryvaryghervakla
flaslepflvqrddnpegvpqevfdgieaaakgdrfawftdfyknfynldenlgsriseq
avtgswnvaigsapvaayavvpawiedfrsdveavraagkptlilhgtkdnilpidatar
rfhqavpeadyvevegaphgllwthadevnaalktflak

SCOP Domain Coordinates for d1hl7b_:

Click to download the PDB-style file with coordinates for d1hl7b_.
(The format of our PDB-style files is described here.)

Timeline for d1hl7b_: