Lineage for d1hknb_ (1hkn B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375317Fold b.42: beta-Trefoil [50352] (6 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 375318Superfamily b.42.1: Cytokine [50353] (2 families) (S)
  5. 375319Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (8 proteins)
  6. 375320Protein Acidic FGF (FGF1) [50357] (3 species)
  7. 375334Species Human (Homo sapiens) [TaxId:9606] [50359] (23 PDB entries)
  8. 375362Domain d1hknb_: 1hkn B: [90639]

Details for d1hknb_

PDB Entry: 1hkn (more details), 2 Å

PDB Description: a complex between acidic fibroblast growth factor and 5-amino-2- naphthalenesulfonate

SCOP Domain Sequences for d1hknb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hknb_ b.42.1.1 (B:) Acidic FGF (FGF1) {Human (Homo sapiens)}
kpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylamdt
dgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygqka
ilflplpvs

SCOP Domain Coordinates for d1hknb_:

Click to download the PDB-style file with coordinates for d1hknb_.
(The format of our PDB-style files is described here.)

Timeline for d1hknb_: