Lineage for d1hkma2 (1hkm A:267-334)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601019Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 601184Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 601185Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 601279Protein Chitotriosidase [82628] (1 species)
  7. 601280Species Human (Homo sapiens) [TaxId:9606] [82629] (8 PDB entries)
  8. 601285Domain d1hkma2: 1hkm A:267-334 [90637]
    Other proteins in same PDB: d1hkma1
    complexed with ali, naa

Details for d1hkma2

PDB Entry: 1hkm (more details), 2.55 Å

PDB Description: high resolution crystal structure of human chitinase in complex with demethylallosamidin

SCOP Domain Sequences for d1hkma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hkma2 d.26.3.1 (A:267-334) Chitotriosidase {Human (Homo sapiens)}
ygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqkvpyif
rdnqwvgf

SCOP Domain Coordinates for d1hkma2:

Click to download the PDB-style file with coordinates for d1hkma2.
(The format of our PDB-style files is described here.)

Timeline for d1hkma2:

601285
d1hkma2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1hkma1