SCOPe 2.08: Domain d1hkma2: 1hkm A:267-334

Lineage for d1hkma2 (1hkm A:267-334)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitotriosidase [82628] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82629] (11 PDB entries)

8. Domain d1hkma2: 1hkm A:267-334 [90637]
   Other proteins in same PDB: d1hkma1
   complexed with ali

Details for d1hkma2

PDB Entry: 1hkm, 2.55 Å

PDB Description: high resolution crystal structure of human chitinase in complex with demethylallosamidin

PDB Compounds: (A:) chitotriosidase

SCOPe Domain Sequences for d1hkma2:

Sequence; same for both SEQRES and ATOM records:

>d1hkma2 d.26.3.1 (A:267-334) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]}
ygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqkvpyif
rdnqwvgf

Timeline for d1hkma2:

• d1hkma2 first appeared in SCOP 1.67
  
• d1hkma2 appears in SCOPe 2.07