Lineage for d1hkma1 (1hkm A:22-266,A:335-386)
- Root: SCOPe 2.07
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) 
Family c.1.8.5: Type II chitinase [51534] (15 proteins)
glycosylase family 18
Protein Chitotriosidase [82251] (1 species) Species Human (Homo sapiens) [TaxId:9606] [82252] (11 PDB entries) 
Domain d1hkma1: 1hkm A:22-266,A:335-386 [90636]
Other proteins in same PDB: d1hkma2
complexed with ali
Details for d1hkma1
PDB Entry: 1hkm (more details), 2.55 Å
PDB Description: high resolution crystal structure of human chitinase in complex with demethylallosamidin
PDB Compounds: (A:) chitotriosidaseSCOPe Domain Sequences for d1hkma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkma1 c.1.8.5 (A:22-266,A:335-386) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]}
aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
qnldfvnlmaydfhgswekvtghnsplykrqeqsgaaaslnvdaavqqwlqkgtpaskli
lgmptXddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtlrqels
SCOPe Domain Coordinates for d1hkma1:
Click to download the PDB-style file with coordinates for d1hkma1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1hkma1:
- d1hkma1 first appeared in SCOP 1.67
- d1hkma1 appears in SCOPe 2.06
- d1hkma1 appears in the current release, SCOPe 2.08
View in 3D
