Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) |
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
Protein Chitotriosidase [82628] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82629] (10 PDB entries) |
Domain d1hkka2: 1hkk A:267-334 [90635] Other proteins in same PDB: d1hkka1 complexed with ami, zn |
PDB Entry: 1hkk (more details), 1.85 Å
SCOPe Domain Sequences for d1hkka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hkka2 d.26.3.1 (A:267-334) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} ygrsftlasssdtrvgapatgsgtpgpftkeggmlayyevcswkgatkqriqdqkvpyif rdnqwvgf
Timeline for d1hkka2: