SCOPe 2.08: Domain d1hkka1: 1hkk A:22-266,A:335-385

Lineage for d1hkka1 (1hkk A:22-266,A:335-385)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.5: Type II chitinase [51534] (15 proteins)
   glycosylase family 18

6. Protein Chitotriosidase [82251] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82252] (11 PDB entries)

8. Domain d1hkka1: 1hkk A:22-266,A:335-385 [90634]
   Other proteins in same PDB: d1hkka2
   complexed with ami, zn

Details for d1hkka1

PDB Entry: 1hkk, 1.85 Å

PDB Description: high resoultion crystal structure of human chitinase in complex with allosamidin

PDB Compounds: (A:) chitotriosidase-1

SCOPe Domain Sequences for d1hkka1:

Sequence; same for both SEQRES and ATOM records:

>d1hkka1 c.1.8.5 (A:22-266,A:335-385) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]}
aklvcyftnwaqyrqgearflpkdldpslcthliyafagmtnhqlsttewndetlyqefn
glkkmnpklktllaiggwnfgtqkftdmvatannrqtfvnsairflrkysfdgldldwey
pgsqgspavdkerfttlvqdlanafqqeaqtsgkerlllsaavpagqtyvdagyevdkia
qnldfvnlmaydfhgswekvtghnsplykrqeqsgaaaslnvdaavqqwlqkgtpaskli
lgmptXddvesfktkvsylkqkglggamvwaldlddfagfscnqgrypliqtlrqel

Timeline for d1hkka1:

• d1hkka1 first appeared in SCOP 1.67
  
• d1hkka1 appears in SCOPe 2.07