Lineage for d1hhva_ (1hhv A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 407213Fold d.9: IL8-like [54116] (1 superfamily)
    beta(3)-alpha
  4. 407214Superfamily d.9.1: Interleukin 8-like chemokines [54117] (1 family) (S)
    form dimers with different dimerisation modes
  5. 407215Family d.9.1.1: Interleukin 8-like chemokines [54118] (24 proteins)
  6. 407283Protein Macrophage inflammatory protein, MIP [54128] (5 species)
    has different dimerisation mode
  7. 407298Species Kaposi's sarcoma herpes virus, VMIP-II [54131] (5 PDB entries)
    anti-HIV chemokine
  8. 407302Domain d1hhva_: 1hhv A: [90625]

Details for d1hhva_

PDB Entry: 1hhv (more details)

PDB Description: solution structure of virus chemokine vmip-ii

SCOP Domain Sequences for d1hhva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hhva_ d.9.1.1 (A:) Macrophage inflammatory protein, MIP {Kaposi's sarcoma herpes virus, VMIP-II}
gdtlgaswhrpdkcclgyqkrplpqvllsswyptsqlcskpgvifltkrgrqvcadkskd
wvkklmqqlpvtar

SCOP Domain Coordinates for d1hhva_:

Click to download the PDB-style file with coordinates for d1hhva_.
(The format of our PDB-style files is described here.)

Timeline for d1hhva_: