Lineage for d1h6na_ (1h6n A:)

  1. Root: SCOP 1.67
  2. 423625Class e: Multi-domain proteins (alpha and beta) [56572] (40 folds)
  3. 424102Fold e.5: Heme-dependent catalases [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 424103Superfamily e.5.1: Heme-dependent catalases [56634] (1 family) (S)
  5. 424104Family e.5.1.1: Heme-dependent catalases [56635] (2 proteins)
  6. 424105Protein Catalase I [56636] (8 species)
  7. 424159Species Proteus mirabilis [TaxId:584] [56640] (8 PDB entries)
  8. 424163Domain d1h6na_: 1h6n A: [90623]
    complexed with act, hem, so4; mutant

Details for d1h6na_

PDB Entry: 1h6n (more details), 2.11 Å

PDB Description: formation of a tyrosyl radical intermediate in proteus mirabilis catalase by directed mutagenesis and consequences for nucleotide reactivity

SCOP Domain Sequences for d1h6na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h6na_ e.5.1.1 (A:) Catalase I {Proteus mirabilis}
kklttaagapvvdnnnvitagprgpmllqdvwfleklahfdreviperrmhakgsgafgt
ftvthditkytrakifsevgkktemfarfstvagergaadaerdirgfalkfyteegnwd
mvgnntpvfylrdplkfpdlnhivkrdprtnmrnmaykwdffshlpeslhqltidmsdrg
lplsyrfvhgygshtysfinkdnerfwvkfhfrcqqgiknlmddeaealvgkdressqrd
lfeaiergdyprwklqiqimpekeastvpynpfdltkvwphadyplmdvgyfelnrnpdn
yfsdveqaafspanivpgisfspdkmlqgrlfsygdahryrlgvnhhqipvnapkcpfhn
yhrdgamrvdgnsgngityepnsggvfqeqpdfkepplsiegaadhwnhrededyfsqpr
alyellsddehqrmfariagelsqasketqqrqidlftkvhpeygagvekaikvle

SCOP Domain Coordinates for d1h6na_:

Click to download the PDB-style file with coordinates for d1h6na_.
(The format of our PDB-style files is described here.)

Timeline for d1h6na_: