Lineage for d1h5za_ (1h5z A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005011Protein Cytochrome p450 14 alpha-sterol demethylase (cyp51) [48276] (1 species)
  7. 2005012Species Mycobacterium tuberculosis [TaxId:1773] [48277] (5 PDB entries)
    Uniprot P0A512 P77901
  8. 2005017Domain d1h5za_: 1h5z A: [90622]
    complexed with fe2, hem

Details for d1h5za_

PDB Entry: 1h5z (more details), 2.05 Å

PDB Description: cytochrome p450 14 alpha-sterol demethylase (cyp51) from mycobacterium tuberculosis in ferric low-spin state
PDB Compounds: (A:) cytochrome p450 51

SCOPe Domain Sequences for d1h5za_:

Sequence, based on SEQRES records: (download)

>d1h5za_ a.104.1.1 (A:) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]}
savalprvsgghdehghleefrtdpiglmqrvrdecgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedqv
rrmiadwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplay
vdpylpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtprf
sadeitgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhal
rqipqlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfpd
phdfvparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaq
ppesyrndhskmvvqlaqpacvryrrrtg

Sequence, based on observed residues (ATOM records): (download)

>d1h5za_ a.104.1.1 (A:) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]}
savalprvsgghdehghleefrtdpiglmqrvrdecgdvgtfqlagkqvvllsgshanef
ffragdddldqakaypfmtpifgegvvfdhnaalrgeqmkghaatiedqvrrmiadwgea
geidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplayvdpylpiesf
rrrdearnglvalvadimngrianpptrdmldvliavkaetgtprfsadeitgmfismmf
aghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhalrqipqlenvlketl
rlhppliilmrvakgefevqghrihegdlvaaspaisnripedfpdphdfvparyeqprq
edllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqppesyrndhskmvv
qlaqpacvryrrrtg

SCOPe Domain Coordinates for d1h5za_:

Click to download the PDB-style file with coordinates for d1h5za_.
(The format of our PDB-style files is described here.)

Timeline for d1h5za_: