SCOP 1.67: Domain d1h4pb_: 1h4p B:

Lineage for d1h4pb_ (1h4p B:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (10 families)

5. Family c.1.8.3: beta-glycanases [51487] (22 proteins)
   consist of a number of sequence families

6. Protein Exo-beta-(1,3)-glucanase [51495] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102065] (1 PDB entry)

8. Domain d1h4pb_: 1h4p B: [90618]
   complexed with gol, man, nag, ndg

Details for d1h4pb_

PDB Entry: 1h4p, 1.75 Å

PDB Description: crystal structure of exo-1,3-beta glucanse from saccharomyces cerevisiae

SCOP Domain Sequences for d1h4pb_:

Sequence; same for both SEQRES and ATOM records:

>d1h4pb_ c.1.8.3 (B:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae)}
yydydhgslgepirgvniggwlllepyitpslfeafrtnddndegipvdeyhfcqylgkd
laksrlqshwstfyqeqdfaniasqgfnlvripigywafqildddpyvsglqesyldqai
gwarnnslkvwvdlhgaagsqngfdnsglrdsykfledsnlavtinvlnyilkkysaeey
ldivigielineplgpvldmdkmkndylapayeylrnniksdqviiihdafqpynywddf
mtendgywgvtidhhhyqvfasdqlersidehikvacewgtgvlneshwivcgefaaalt
dcikwlnsvgfgarydgswvngdqtssyigscannddiaywsderkentrryveaqldaf
emrggwiiwcyktesslewdaqrlmfnglfpqpltdrkypnqcgtisn

Timeline for d1h4pb_:

• d1h4pb_ is new in SCOP 1.67
  
• d1h4pb_ appears in SCOP 1.69
  
• d1h4pb_ appears in the current release, SCOPe 2.08