Lineage for d1h4pa_ (1h4p A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 384382Superfamily c.1.8: (Trans)glycosidases [51445] (10 families) (S)
  5. 384721Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 384948Protein Exo-beta-(1,3)-glucanase [51495] (2 species)
  7. 384949Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102065] (1 PDB entry)
  8. 384950Domain d1h4pa_: 1h4p A: [90617]

Details for d1h4pa_

PDB Entry: 1h4p (more details), 1.75 Å

PDB Description: crystal structure of exo-1,3-beta glucanse from saccharomyces cerevisiae

SCOP Domain Sequences for d1h4pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae)}
yydydhgslgepirgvniggwlllepyitpslfeafrtnddndegipvdeyhfcqylgkd
laksrlqshwstfyqeqdfaniasqgfnlvripigywafqildddpyvsglqesyldqai
gwarnnslkvwvdlhgaagsqngfdnsglrdsykfledsnlavtinvlnyilkkysaeey
ldivigielineplgpvldmdkmkndylapayeylrnniksdqviiihdafqpynywddf
mtendgywgvtidhhhyqvfasdqlersidehikvacewgtgvlneshwivcgefaaalt
dcikwlnsvgfgarydgswvngdqtssyigscannddiaywsderkentrryveaqldaf
emrggwiiwcyktesslewdaqrlmfnglfpqpltdrkypnqcgtisn

SCOP Domain Coordinates for d1h4pa_:

Click to download the PDB-style file with coordinates for d1h4pa_.
(The format of our PDB-style files is described here.)

Timeline for d1h4pa_: