Lineage for d1h4fd2 (1h4f D:254-406)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 403921Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 403922Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 403923Family c.95.1.1: Thiolase-related [53902] (6 proteins)
  6. 403924Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
  7. 403925Species Escherichia coli [TaxId:562] [53908] (9 PDB entries)
  8. 403941Domain d1h4fd2: 1h4f D:254-406 [90616]
    complexed with nh4; mutant

Details for d1h4fd2

PDB Entry: 1h4f (more details), 2 Å

PDB Description: e. coli beta-ketoacyl [acyl carrier protein] synthase i k328r

SCOP Domain Sequences for d1h4fd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4fd2 c.95.1.1 (D:254-406) Beta-ketoacyl-ACP synthase I {Escherichia coli}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatramtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

SCOP Domain Coordinates for d1h4fd2:

Click to download the PDB-style file with coordinates for d1h4fd2.
(The format of our PDB-style files is described here.)

Timeline for d1h4fd2: