| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (2 families) ![]() |
| Family c.95.1.1: Thiolase-related [53902] (8 proteins) |
| Protein Beta-ketoacyl-ACP synthase I [53907] (1 species) |
| Species Escherichia coli [TaxId:562] [53908] (19 PDB entries) |
| Domain d1h4fc2: 1h4f C:254-406 [90614] |
PDB Entry: 1h4f (more details), 2 Å
SCOP Domain Sequences for d1h4fc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h4fc2 c.95.1.1 (C:254-406) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatramtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd
Timeline for d1h4fc2: