Lineage for d1h4fb1 (1h4f B:1-253)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495246Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 495247Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 495248Family c.95.1.1: Thiolase-related [53902] (7 proteins)
  6. 495269Protein Beta-ketoacyl-ACP synthase I [53907] (1 species)
  7. 495270Species Escherichia coli [TaxId:562] [53908] (11 PDB entries)
  8. 495297Domain d1h4fb1: 1h4f B:1-253 [90611]

Details for d1h4fb1

PDB Entry: 1h4f (more details), 2 Å

PDB Description: e. coli beta-ketoacyl [acyl carrier protein] synthase i k328r

SCOP Domain Sequences for d1h4fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h4fb1 c.95.1.1 (B:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli}
mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
eelehalargahi

SCOP Domain Coordinates for d1h4fb1:

Click to download the PDB-style file with coordinates for d1h4fb1.
(The format of our PDB-style files is described here.)

Timeline for d1h4fb1: