Lineage for d1h42a1 (1h42 A:9-141)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793458Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2793526Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
    coupled with a NADP-binding domain of alpha/beta class
  6. 2793554Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)
  7. Species Anabaena sp., pcc 7119 [TaxId:1167] [50420] (19 PDB entries)
  8. 2793566Domain d1h42a1: 1h42 A:9-141 [90606]
    Other proteins in same PDB: d1h42a2
    complexed with fad, so4; mutant

Details for d1h42a1

PDB Entry: 1h42 (more details), 2.15 Å

PDB Description: ferredoxin:nadp+ reductase mutant with thr 155 replaced by gly, ala 160 replaced by thr and leu 263 replaced by pro (t155g-a160t-l263p)
PDB Compounds: (A:) ferredoxin--nadp+ reductase

SCOPe Domain Sequences for d1h42a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h42a1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Anabaena sp., pcc 7119 [TaxId: 1167]}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgkeml

SCOPe Domain Coordinates for d1h42a1:

Click to download the PDB-style file with coordinates for d1h42a1.
(The format of our PDB-style files is described here.)

Timeline for d1h42a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h42a2