Lineage for d1h3xa1 (1h3x A:238-341)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2027898Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)
  7. 2027899Species Human (Homo sapiens) [TaxId:9606] [88585] (57 PDB entries)
    Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region
  8. 2027956Domain d1h3xa1: 1h3x A:238-341 [90602]
    Other proteins in same PDB: d1h3xa2, d1h3xb2
    part of a Fc

Details for d1h3xa1

PDB Entry: 1h3x (more details), 2.44 Å

PDB Description: crystal structure of the human igg1 fc-fragment,glycoform (g0f)2
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d1h3xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3xa1 b.1.1.2 (A:238-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]}
psvflfppkpkdtlmisrtpevtcvvvdvshedpqvkfnwyvdgvqvhnaktkpreqqyn
styrvvsvltvlhqnwldgkeykckvsnkalpapiektiskakg

SCOPe Domain Coordinates for d1h3xa1:

Click to download the PDB-style file with coordinates for d1h3xa1.
(The format of our PDB-style files is described here.)

Timeline for d1h3xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h3xa2