Lineage for d1h3ma_ (1h3m A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133681Family c.68.1.13: Cytidylytransferase [68901] (7 protein domains)
  6. 2133682Protein 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) [64140] (4 species)
  7. 2133683Species Escherichia coli [TaxId:562] [64141] (6 PDB entries)
  8. 2133689Domain d1h3ma_: 1h3m A: [90600]
    complexed with cl, n2p

Details for d1h3ma_

PDB Entry: 1h3m (more details), 2.4 Å

PDB Description: structure of 4-diphosphocytidyl-2c-methyl-d-erythritol synthetase
PDB Compounds: (A:) 2-c-methyl-d-erythritol 4-phosphate cytidylyltransferase

SCOPe Domain Sequences for d1h3ma_:

Sequence, based on SEQRES records: (download)

>d1h3ma_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]}
ldvcavvpaagfgrrmqtecpkqylsignqtilehsvhallahprvkrvviaispgdsrf
aqlplanhpqitvvdggderadsvltglkaagdaqwvlvhdaarpclhqddlarllalse
tsrtggilaapvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltralneg
atitdeasaleycgfhpqlvegradnikvtrpedlalaefyltr

Sequence, based on observed residues (ATOM records): (download)

>d1h3ma_ c.68.1.13 (A:) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Escherichia coli [TaxId: 562]}
ldvcavvpaacpkqylsignqtilehsvhallahprvkrvviaispgdsrfaqlplanhp
qitvvdggderadsvltglkaagdaqwvlvhdaarpclhqddlarllalsetsrtggila
apvrdtmkraepgknaiahtvdrnglwhaltpqffprellhdcltralnegatitdeasa
leycgfhpqlvegradnikvtrpedlalaefyltr

SCOPe Domain Coordinates for d1h3ma_:

Click to download the PDB-style file with coordinates for d1h3ma_.
(The format of our PDB-style files is described here.)

Timeline for d1h3ma_: