SCOPe 2.08: Domain d1h3gb3: 1h3g B:96-517

Lineage for d1h3gb3 (1h3g B:96-517)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein Cyclomaltodextrinase, central domain [102058] (1 species)
   protein shares similar domain organization with maltogenic amylases but differs in the spatial arrangement of its domains

7. Species Flavobacterium sp. 92 [TaxId:197856] [102059] (6 PDB entries)

8. Domain d1h3gb3: 1h3g B:96-517 [90599]
   Other proteins in same PDB: d1h3ga1, d1h3ga2, d1h3ga4, d1h3gb1, d1h3gb2, d1h3gb4
   complexed with ca

Details for d1h3gb3

PDB Entry: 1h3g, 2.1 Å

PDB Description: cyclomaltodextrinase from flavobacterium sp. no. 92: from dna sequence to protein structure

PDB Compounds: (B:) cyclomaltodextrinase

SCOPe Domain Sequences for d1h3gb3:

Sequence; same for both SEQRES and ATOM records:

>d1h3gb3 c.1.8.1 (B:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]}
gsaqrqgfgpgdaiyqimpdrfangdpsndnvagmreqadrrhgggrhggdirgtidhld
yiaglgftqlwptplvendaaaysyhgyaatdhyridprygsnedfvrlstearkrgmgl
iqdvvlshigkhhwwmkdlptpdwinyggkfvptqhhrvavqdpyaaqadsenftkgwfv
egmpdlnqtnplvanyliqnniwwieyaglsglridtygysdgaflteytrrlmaeyprl
nmvgeewstrvpvvarwqrgkanfdgytshlpslmdfplvdamrnalsktgeenglnevy
etlsldylypepqnlvlfggnhdmarmfsaagedfdrwrmnlvflmtmpripqfysgdei
lmtstvkgrddasyrrdfpggwagdkanafsgagltsqqraaqdlvrklanwrknqpvih
ng

Timeline for d1h3gb3:

• d1h3gb3 first appeared in SCOP 1.67
  
• d1h3gb3 appears in SCOPe 2.07