Lineage for d1h3gb2 (1h3g B:518-600)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810333Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2810563Protein Cyclomaltodextrinase [101917] (1 species)
    protein shares similar domain organization with maltogenic amylases but differs in the spatial arrangement of its domains
  7. 2810564Species Flavobacterium sp. 92 [TaxId:197856] [101918] (1 PDB entry)
  8. 2810566Domain d1h3gb2: 1h3g B:518-600 [90598]
    Other proteins in same PDB: d1h3ga1, d1h3ga3, d1h3ga4, d1h3gb1, d1h3gb3, d1h3gb4
    complexed with ca

Details for d1h3gb2

PDB Entry: 1h3g (more details), 2.1 Å

PDB Description: cyclomaltodextrinase from flavobacterium sp. no. 92: from dna sequence to protein structure
PDB Compounds: (B:) cyclomaltodextrinase

SCOPe Domain Sequences for d1h3gb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3gb2 b.71.1.1 (B:518-600) Cyclomaltodextrinase {Flavobacterium sp. 92 [TaxId: 197856]}
rlmhfgpeentwvyfrynkdkrimvamnnndkpmtlptarfqemlkgapsgvdflsgktv
glgrelrlapksvvvielpglpe

SCOPe Domain Coordinates for d1h3gb2:

Click to download the PDB-style file with coordinates for d1h3gb2.
(The format of our PDB-style files is described here.)

Timeline for d1h3gb2: