![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Cyclomaltodextrinase, central domain [102058] (1 species) protein shares similar domain organization with maltogenic amylases but differs in the spatial arrangement of its domains |
![]() | Species Flavobacterium sp. 92 [TaxId:197856] [102059] (1 PDB entry) |
![]() | Domain d1h3ga3: 1h3g A:96-517 [90596] Other proteins in same PDB: d1h3ga1, d1h3ga2, d1h3gb1, d1h3gb2 complexed with ca |
PDB Entry: 1h3g (more details), 2.1 Å
SCOPe Domain Sequences for d1h3ga3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} gsaqrqgfgpgdaiyqimpdrfangdpsndnvagmreqadrrhgggrhggdirgtidhld yiaglgftqlwptplvendaaaysyhgyaatdhyridprygsnedfvrlstearkrgmgl iqdvvlshigkhhwwmkdlptpdwinyggkfvptqhhrvavqdpyaaqadsenftkgwfv egmpdlnqtnplvanyliqnniwwieyaglsglridtygysdgaflteytrrlmaeyprl nmvgeewstrvpvvarwqrgkanfdgytshlpslmdfplvdamrnalsktgeenglnevy etlsldylypepqnlvlfggnhdmarmfsaagedfdrwrmnlvflmtmpripqfysgdei lmtstvkgrddasyrrdfpggwagdkanafsgagltsqqraaqdlvrklanwrknqpvih ng
Timeline for d1h3ga3: