Lineage for d1h3ga3 (1h3g A:96-517)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830127Protein Cyclomaltodextrinase, central domain [102058] (1 species)
    protein shares similar domain organization with maltogenic amylases but differs in the spatial arrangement of its domains
  7. 2830128Species Flavobacterium sp. 92 [TaxId:197856] [102059] (6 PDB entries)
  8. 2830137Domain d1h3ga3: 1h3g A:96-517 [90596]
    Other proteins in same PDB: d1h3ga1, d1h3ga2, d1h3ga4, d1h3gb1, d1h3gb2, d1h3gb4
    complexed with ca

Details for d1h3ga3

PDB Entry: 1h3g (more details), 2.1 Å

PDB Description: cyclomaltodextrinase from flavobacterium sp. no. 92: from dna sequence to protein structure
PDB Compounds: (A:) cyclomaltodextrinase

SCOPe Domain Sequences for d1h3ga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]}
gsaqrqgfgpgdaiyqimpdrfangdpsndnvagmreqadrrhgggrhggdirgtidhld
yiaglgftqlwptplvendaaaysyhgyaatdhyridprygsnedfvrlstearkrgmgl
iqdvvlshigkhhwwmkdlptpdwinyggkfvptqhhrvavqdpyaaqadsenftkgwfv
egmpdlnqtnplvanyliqnniwwieyaglsglridtygysdgaflteytrrlmaeyprl
nmvgeewstrvpvvarwqrgkanfdgytshlpslmdfplvdamrnalsktgeenglnevy
etlsldylypepqnlvlfggnhdmarmfsaagedfdrwrmnlvflmtmpripqfysgdei
lmtstvkgrddasyrrdfpggwagdkanafsgagltsqqraaqdlvrklanwrknqpvih
ng

SCOPe Domain Coordinates for d1h3ga3:

Click to download the PDB-style file with coordinates for d1h3ga3.
(The format of our PDB-style files is described here.)

Timeline for d1h3ga3: