SCOP 1.67: Domain d1h3ga1: 1h3g A:3-95

Lineage for d1h3ga1 (1h3g A:3-95)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (16 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Cyclomaltodextrinase, N-terminal domain [101523] (1 species)
   protein shares similar domain organization with maltogenic amylases but differs in the spatial arrangement of its domains

7. Species Flavobacterium sp. 92 [TaxId:197856] [101524] (1 PDB entry)

8. Domain d1h3ga1: 1h3g A:3-95 [90594]
   Other proteins in same PDB: d1h3ga2, d1h3ga3, d1h3gb2, d1h3gb3

Details for d1h3ga1

PDB Entry: 1h3g, 2.1 Å

PDB Description: cyclomaltodextrinase from flavobacterium sp. no. 92: from dna sequence to protein structure

SCOP Domain Sequences for d1h3ga1:

Sequence; same for both SEQRES and ATOM records:

>d1h3ga1 b.1.18.2 (A:3-95) Cyclomaltodextrinase, N-terminal domain {Flavobacterium sp. 92}
ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsttrvpnanylfvdl
eigpeaqpgsfdivfkgdgrseryryrllareq

Timeline for d1h3ga1:

• d1h3ga1 is new in SCOP 1.67
  
• d1h3ga1 appears in SCOP 1.69
  
• d1h3ga1 appears in the current release, SCOPe 2.08