SCOP 1.71: Domain d1h3da1: 1h3d A:5-224

Lineage for d1h3da1 (1h3d A:5-224)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (29 proteins)

6. Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (3 species)
   there is an additional C-terminal allosteric domain in some species

7. Species Escherichia coli [TaxId:562] [102698] (2 PDB entries)

8. Domain d1h3da1: 1h3d A:5-224 [90592]
   Other proteins in same PDB: d1h3da2
   complexed with amp, tla

Details for d1h3da1

PDB Entry: 1h3d, 2.7 Å

PDB Description: structure of the e.coli atp-phosphoribosyltransferase

SCOP Domain Sequences for d1h3da1:

Sequence; same for both SEQRES and ATOM records:

>d1h3da1 c.94.1.1 (A:5-224) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Escherichia coli}
trlriamqksgrlsddsrellarcgikinlhtqrliamaenmpidilrvrdddipglvmd
gvvdlgiigenvleeellnrraqgedpryftlrrldfggcrlslatpvdeawdgplslng
kriatsyphllkryldqkgisfkscllngsvevapragladaicdlvstgatleanglre
veviyrskacliqrdgemeeskqqlidklltriqgviqar

Timeline for d1h3da1:

• d1h3da1 first appeared in SCOP 1.67
  
• d1h3da1 appears in SCOP 1.69
  
• d1h3da1 appears in SCOP 1.73
  
• d1h3da1 appears in the current release, SCOPe 2.08