| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (2 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (29 proteins) |
| Protein ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain [82559] (3 species) there is an additional C-terminal allosteric domain in some species |
| Species Escherichia coli [TaxId:562] [102698] (2 PDB entries) |
| Domain d1h3da1: 1h3d A:5-224 [90592] Other proteins in same PDB: d1h3da2 complexed with amp, tla |
PDB Entry: 1h3d (more details), 2.7 Å
SCOP Domain Sequences for d1h3da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3da1 c.94.1.1 (A:5-224) ATP phosphoribosyltransferase (ATP-PRTase, HisG), catalytic domain {Escherichia coli}
trlriamqksgrlsddsrellarcgikinlhtqrliamaenmpidilrvrdddipglvmd
gvvdlgiigenvleeellnrraqgedpryftlrrldfggcrlslatpvdeawdgplslng
kriatsyphllkryldqkgisfkscllngsvevapragladaicdlvstgatleanglre
veviyrskacliqrdgemeeskqqlidklltriqgviqar
Timeline for d1h3da1: