Lineage for d1h3cc1 (1h3c C:10-36,C:308-629)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 774162Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 774411Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 774437Family a.102.4.2: Terpene synthases [48243] (2 proteins)
    consists of two toroid domains: one of six and one of five hairpins
  6. 774444Protein Squalene-hopene cyclase [48244] (1 species)
  7. 774445Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries)
  8. 774534Domain d1h3cc1: 1h3c C:10-36,C:308-629 [90590]

Details for d1h3cc1

PDB Entry: 1h3c (more details), 2.9 Å

PDB Description: structures of human oxidosqualene cyclase inhibitors bound to an homologous enzyme
PDB Compounds: (C:) squalene--hopene cyclase

SCOP Domain Sequences for d1h3cc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3cc1 a.102.4.2 (C:10-36,C:308-629) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
ayartldraveyllscqkdegywwgplXispvwdtglavlalraaglpadhdrlvkagew
lldrqitvpgdwavkrpnlkpggfafqfdnvyypdvddtavvvwalntlrlpderrrrda
mtkgfrwivgmqssnggwgaydvdntsdlpnhipfcdfgevtdppsedvtahvlecfgsf
gyddawkvirraveylkreqkpdgswfgrwgvnylygtgavvsalkavgidtrepyiqka
ldwveqhqnpdggwgedcrsyedpayagkgastpsqtawalmaliaggraeseaarrgvq
ylvetqrpdggwdepyytgtgfpgdfylgytmyrhvfptlalgrykqaie

SCOP Domain Coordinates for d1h3cc1:

Click to download the PDB-style file with coordinates for d1h3cc1.
(The format of our PDB-style files is described here.)

Timeline for d1h3cc1: