Class a: All alpha proteins [46456] (202 folds) |
Fold a.102: alpha/alpha toroid [48207] (5 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) |
Family a.102.4.2: Terpene synthases [48243] (1 protein) consists of two toroid domains: one of six and one of five hairpins |
Protein Squalene-hopene cyclase [48244] (1 species) |
Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries) |
Domain d1h3bb1: 1h3b B:10-36,B:308-629 [90582] |
PDB Entry: 1h3b (more details), 2.8 Å
SCOP Domain Sequences for d1h3bb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3bb1 a.102.4.2 (B:10-36,B:308-629) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius} ayartldraveyllscqkdegywwgplXispvwdtglavlalraaglpadhdrlvkagew lldrqitvpgdwavkrpnlkpggfafqfdnvyypdvddtavvvwalntlrlpderrrrda mtkgfrwivgmqssnggwgaydvdntsdlpnhipfcdfgevtdppsedvtahvlecfgsf gyddawkvirraveylkreqkpdgswfgrwgvnylygtgavvsalkavgidtrepyiqka ldwveqhqnpdggwgedcrsyedpayagkgastpsqtawalmaliaggraeseaarrgvq ylvetqrpdggwdepyytgtgfpgdfylgytmyrhvfptlalgrykqaie
Timeline for d1h3bb1:
View in 3D Domains from other chains: (mouse over for more information) d1h3ba1, d1h3ba2, d1h3bc1, d1h3bc2 |