Lineage for d1h3bb1 (1h3b B:10-36,B:308-629)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358916Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 359095Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) (S)
  5. 359121Family a.102.4.2: Terpene synthases [48243] (1 protein)
    consists of two toroid domains: one of six and one of five hairpins
  6. 359122Protein Squalene-hopene cyclase [48244] (1 species)
  7. 359123Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries)
  8. 359156Domain d1h3bb1: 1h3b B:10-36,B:308-629 [90582]

Details for d1h3bb1

PDB Entry: 1h3b (more details), 2.8 Å

PDB Description: squalene-hopene cyclase

SCOP Domain Sequences for d1h3bb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h3bb1 a.102.4.2 (B:10-36,B:308-629) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius}
ayartldraveyllscqkdegywwgplXispvwdtglavlalraaglpadhdrlvkagew
lldrqitvpgdwavkrpnlkpggfafqfdnvyypdvddtavvvwalntlrlpderrrrda
mtkgfrwivgmqssnggwgaydvdntsdlpnhipfcdfgevtdppsedvtahvlecfgsf
gyddawkvirraveylkreqkpdgswfgrwgvnylygtgavvsalkavgidtrepyiqka
ldwveqhqnpdggwgedcrsyedpayagkgastpsqtawalmaliaggraeseaarrgvq
ylvetqrpdggwdepyytgtgfpgdfylgytmyrhvfptlalgrykqaie

SCOP Domain Coordinates for d1h3bb1:

Click to download the PDB-style file with coordinates for d1h3bb1.
(The format of our PDB-style files is described here.)

Timeline for d1h3bb1: