SCOPe 2.07: Domain d1h3bb1: 1h3b B:10-36,B:308-629

Lineage for d1h3bb1 (1h3b B:10-36,B:308-629)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.2: Terpene synthases [48243] (2 proteins)
   consists of two toroid domains: one of six and one of five hairpins

6. Protein Squalene-hopene cyclase [48244] (1 species)

7. Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries)

8. Domain d1h3bb1: 1h3b B:10-36,B:308-629 [90582]
   complexed with c8e, r46

Details for d1h3bb1

PDB Entry: 1h3b, 2.8 Å

PDB Description: squalene-hopene cyclase

PDB Compounds: (B:) squalene--hopene cyclase

SCOPe Domain Sequences for d1h3bb1:

Sequence; same for both SEQRES and ATOM records:

>d1h3bb1 a.102.4.2 (B:10-36,B:308-629) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
ayartldraveyllscqkdegywwgplXispvwdtglavlalraaglpadhdrlvkagew
lldrqitvpgdwavkrpnlkpggfafqfdnvyypdvddtavvvwalntlrlpderrrrda
mtkgfrwivgmqssnggwgaydvdntsdlpnhipfcdfgevtdppsedvtahvlecfgsf
gyddawkvirraveylkreqkpdgswfgrwgvnylygtgavvsalkavgidtrepyiqka
ldwveqhqnpdggwgedcrsyedpayagkgastpsqtawalmaliaggraeseaarrgvq
ylvetqrpdggwdepyytgtgfpgdfylgytmyrhvfptlalgrykqaie

Timeline for d1h3bb1:

• d1h3bb1 first appeared in SCOP 1.67
  
• d1h3bb1 appears in SCOPe 2.06