| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) ![]() |
| Family a.102.4.2: Terpene synthases [48243] (3 proteins) consists of two toroid domains: one of six and one of five hairpins |
| Protein Squalene-hopene cyclase [48244] (1 species) |
| Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries) |
| Domain d1h3aa2: 1h3a A:37-307 [90575] complexed with c8e, r04 |
PDB Entry: 1h3a (more details), 2.85 Å
SCOPe Domain Sequences for d1h3aa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h3aa2 a.102.4.2 (A:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
lsnvtmeaeyvllchildrvdrdrmekirryllheqredgtwalypggppdldttieayv
alkyigmsrdeepmqkalrfiqsqggiessrvftrmwlalvgeypwekvpmvppeimflg
krmplniyefgswaratvvalsivmsrqpvfplperarvpelyetdvpprrrgakggggw
ifdaldralhgyqklsvhpfrraaeiraldwllerqagdgswggiqppwfyalialkild
mtqhpafikgweglelygveldyggwmfqas
Timeline for d1h3aa2:
View in 3DDomains from other chains: (mouse over for more information) d1h3ab1, d1h3ab2, d1h3ac1, d1h3ac2 |