SCOP 1.71: Domain d1h37a1: 1h37 A:10-36,A:308-629

Lineage for d1h37a1 (1h37 A:10-36,A:308-629)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.102: alpha/alpha toroid [48207] (5 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families)

5. Family a.102.4.2: Terpene synthases [48243] (2 proteins)
   consists of two toroid domains: one of six and one of five hairpins

6. Protein Squalene-hopene cyclase [48244] (1 species)

7. Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries)

8. Domain d1h37a1: 1h37 A:10-36,A:308-629 [90562]

Details for d1h37a1

PDB Entry: 1h37, 2.8 Å

PDB Description: structures of human oxidosqualene cyclase inhibitors bound to an homologous enzyme

SCOP Domain Sequences for d1h37a1:

Sequence; same for both SEQRES and ATOM records:

>d1h37a1 a.102.4.2 (A:10-36,A:308-629) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius}
ayartldraveyllscqkdegywwgplXispvwdtglavlalraaglpadhdrlvkagew
lldrqitvpgdwavkrpnlkpggfafqfdnvyypdvddtavvvwalntlrlpderrrrda
mtkgfrwivgmqssnggwgaydvdntsdlpnhipfcdfgevtdppsedvtahvlecfgsf
gyddawkvirraveylkreqkpdgswfgrwgvnylygtgavvsalkavgidtrepyiqka
ldwveqhqnpdggwgedcrsyedpayagkgastpsqtawalmaliaggraeseaarrgvq
ylvetqrpdggwdepyytgtgfpgdfylgytmyrhvfptlalgrykqaie

Timeline for d1h37a1:

• d1h37a1 first appeared in SCOP 1.67
  
• d1h37a1 appears in SCOP 1.69
  
• d1h37a1 appears in SCOP 1.73
  
• d1h37a1 appears in the current release, SCOPe 2.08