| Class a: All alpha proteins [46456] (226 folds) |
| Fold a.102: alpha/alpha toroid [48207] (5 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) ![]() |
| Family a.102.4.2: Terpene synthases [48243] (2 proteins) consists of two toroid domains: one of six and one of five hairpins |
| Protein Squalene-hopene cyclase [48244] (1 species) |
| Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries) |
| Domain d1h36c2: 1h36 C:37-307 [90561] complexed with c8e, r88 |
PDB Entry: 1h36 (more details), 2.8 Å
SCOP Domain Sequences for d1h36c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h36c2 a.102.4.2 (C:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius}
lsnvtmeaeyvllchildrvdrdrmekirryllheqredgtwalypggppdldttieayv
alkyigmsrdeepmqkalrfiqsqggiessrvftrmwlalvgeypwekvpmvppeimflg
krmplniyefgswaratvvalsivmsrqpvfplperarvpelyetdvpprrrgakggggw
ifdaldralhgyqklsvhpfrraaeiraldwllerqagdgswggiqppwfyalialkild
mtqhpafikgweglelygveldyggwmfqas
Timeline for d1h36c2:
View in 3DDomains from other chains: (mouse over for more information) d1h36a1, d1h36a2, d1h36b1, d1h36b2 |