SCOPe 2.08: Domain d1h36b2: 1h36 B:37-307

Lineage for d1h36b2 (1h36 B:37-307)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.2: Terpene synthases [48243] (3 proteins)
   consists of two toroid domains: one of six and one of five hairpins

6. Protein Squalene-hopene cyclase [48244] (1 species)

7. Species Alicyclobacillus acidocaldarius [TaxId:405212] [48245] (16 PDB entries)

8. Domain d1h36b2: 1h36 B:37-307 [90559]
   complexed with c8e, r88

Details for d1h36b2

PDB Entry: 1h36, 2.8 Å

PDB Description: structures of human oxidosqualene cyclase inhibitors bound to an homologous enzyme

PDB Compounds: (B:) squalene--hopene cyclase

SCOPe Domain Sequences for d1h36b2:

Sequence; same for both SEQRES and ATOM records:

>d1h36b2 a.102.4.2 (B:37-307) Squalene-hopene cyclase {Alicyclobacillus acidocaldarius [TaxId: 405212]}
lsnvtmeaeyvllchildrvdrdrmekirryllheqredgtwalypggppdldttieayv
alkyigmsrdeepmqkalrfiqsqggiessrvftrmwlalvgeypwekvpmvppeimflg
krmplniyefgswaratvvalsivmsrqpvfplperarvpelyetdvpprrrgakggggw
ifdaldralhgyqklsvhpfrraaeiraldwllerqagdgswggiqppwfyalialkild
mtqhpafikgweglelygveldyggwmfqas

Timeline for d1h36b2:

• d1h36b2 first appeared in SCOP 1.67
  
• d1h36b2 appears in SCOPe 2.07