Lineage for d1h2oa_ (1h2o A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872515Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 872733Superfamily d.129.3: Bet v1-like [55961] (10 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 872734Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (4 proteins)
  6. 872745Protein Major tree pollen allergen [55963] (4 species)
  7. 872753Species Sweet cherry (Prunus avium), pru av 1 [TaxId:42229] [64387] (2 PDB entries)
  8. 872755Domain d1h2oa_: 1h2o A: [90547]
    mutant

Details for d1h2oa_

PDB Entry: 1h2o (more details)

PDB Description: solution structure of the major cherry allergen pru av 1 mutant e45w
PDB Compounds: (A:) major allergen pru av 1

SCOP Domain Sequences for d1h2oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2oa_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]}
gvftyeseftseippprlfkafvldadnlvpkiapqaikhseilwgdggpgtikkitfge
gsqygyvkhkidsidkenysysytliegdalgdtlekisyetklvaspsggsiikstshy
htkgnveikeehvkagkekasnlfklietylkghpdayn

SCOP Domain Coordinates for d1h2oa_:

Click to download the PDB-style file with coordinates for d1h2oa_.
(The format of our PDB-style files is described here.)

Timeline for d1h2oa_: