Lineage for d1h2oa_ (1h2o A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975505Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2975515Protein Major tree pollen allergen [55963] (4 species)
  7. 2975523Species Sweet cherry (Prunus avium), pru av 1 [TaxId:42229] [64387] (2 PDB entries)
  8. 2975525Domain d1h2oa_: 1h2o A: [90547]
    mutant

Details for d1h2oa_

PDB Entry: 1h2o (more details)

PDB Description: solution structure of the major cherry allergen pru av 1 mutant e45w
PDB Compounds: (A:) major allergen pru av 1

SCOPe Domain Sequences for d1h2oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h2oa_ d.129.3.1 (A:) Major tree pollen allergen {Sweet cherry (Prunus avium), pru av 1 [TaxId: 42229]}
gvftyeseftseippprlfkafvldadnlvpkiapqaikhseilwgdggpgtikkitfge
gsqygyvkhkidsidkenysysytliegdalgdtlekisyetklvaspsggsiikstshy
htkgnveikeehvkagkekasnlfklietylkghpdayn

SCOPe Domain Coordinates for d1h2oa_:

Click to download the PDB-style file with coordinates for d1h2oa_.
(The format of our PDB-style files is described here.)

Timeline for d1h2oa_: