SCOPe 2.05: Domain d1h2bb2: 1h2b B:155-326

Lineage for d1h2bb2 (1h2b B:155-326)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
   N-terminal all-beta domain defines family

6. Protein Alcohol dehydrogenase [51737] (9 species)

7. Species Aeropyrum pernix [TaxId:56636] [102121] (1 PDB entry)

8. Domain d1h2bb2: 1h2b B:155-326 [90546]
   Other proteins in same PDB: d1h2ba1, d1h2bb1
   complexed with naj, oca, zn

Details for d1h2bb2

PDB Entry: 1h2b, 1.62 Å

PDB Description: crystal structure of the alcohol dehydrogenase from the hyperthermophilic archaeon aeropyrum pernix at 1.65a resolution

PDB Compounds: (B:) alcohol dehydrogenase

SCOPe Domain Sequences for d1h2bb2:

Sequence; same for both SEQRES and ATOM records:

>d1h2bb2 c.2.1.1 (B:155-326) Alcohol dehydrogenase {Aeropyrum pernix [TaxId: 56636]}
isreklvemapladagitayravkkaartlypgayvaivgvgglghiavqllkvmtpatv
ialdvkeeklklaerlgadhvvdarrdpvkqvmeltrgrgvnvamdfvgsqatvdytpyl
lgrmgrliivgyggelrfptirvissevsfegslvgnyvelhelvtlalqgk

Timeline for d1h2bb2:

• d1h2bb2 first appeared in SCOP 1.67
  
• d1h2bb2 appears in SCOPe 2.04
  
• d1h2bb2 appears in SCOPe 2.06
  
• d1h2bb2 appears in the current release, SCOPe 2.08