SCOPe 2.07: Domain d1h1ca_: 1h1c A:

Lineage for d1h1ca_ (1h1c A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.1: AAT-like [53384] (17 proteins)

6. Protein Histidinol-phosphate aminotransferase HisC [64121] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [102594] (5 PDB entries)
   Uniprot Q9X0D0
   TM1040

8. Domain d1h1ca_: 1h1c A: [90538]
   complexed with plp

Details for d1h1ca_

PDB Entry: 1h1c, 2.85 Å

PDB Description: histidinol-phosphate aminotransferase (hisc) from thermotoga maritima

PDB Compounds: (A:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d1h1ca_:

Sequence; same for both SEQRES and ATOM records:

>d1h1ca_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]}
liakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdeelieki
lsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakflevpl
tkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefhgesyv
dflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmfakval
dhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehlrtknv
avrsfregvritigkreendmilrelevfk

Timeline for d1h1ca_:

• d1h1ca_ first appeared in SCOP 1.67
  
• d1h1ca_ appears in SCOPe 2.06
  
• d1h1ca_ appears in the current release, SCOPe 2.08