Lineage for d1h1ca_ (1h1c A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2130992Family c.67.1.1: AAT-like [53384] (17 protein domains)
  6. 2131239Protein Histidinol-phosphate aminotransferase HisC [64121] (2 species)
  7. 2131247Species Thermotoga maritima [TaxId:2336] [102594] (5 PDB entries)
    Uniprot Q9X0D0
    TM1040
  8. 2131262Domain d1h1ca_: 1h1c A: [90538]
    complexed with plp

Details for d1h1ca_

PDB Entry: 1h1c (more details), 2.85 Å

PDB Description: histidinol-phosphate aminotransferase (hisc) from thermotoga maritima
PDB Compounds: (A:) Histidinol-phosphate aminotransferase

SCOPe Domain Sequences for d1h1ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h1ca_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]}
liakraypyetekrdktylalnenpfpfpedlvdevfrrlnsdalriyydspdeelieki
lsyldtdflsknnvsvgngadeiiyvmmlmfdrsvffpptyscyrifakavgakflevpl
tkdlripevnvgegdvvfipnpnnptghvfereeierilktgafvaldeayyefhgesyv
dflkkyenlavirtfskafslaaqrvgyvvasekfidaynrvrlpfnvsyvsqmfakval
dhreifeertkfiveerermksalremgyritdsrgnfvfvfmekeekerllehlrtknv
avrsfregvritigkreendmilrelevfk

SCOPe Domain Coordinates for d1h1ca_:

Click to download the PDB-style file with coordinates for d1h1ca_.
(The format of our PDB-style files is described here.)

Timeline for d1h1ca_: