SCOP 1.73: Domain d1gzwb_: 1gzw B:

Lineage for d1gzwb_ (1gzw B:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.3: Galectin (animal S-lectin) [49932] (8 proteins)

6. Protein Galectin-1 [100925] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101638] (6 PDB entries)

8. Domain d1gzwb_: 1gzw B: [90536]
   complexed with bgc, gal, seo, so4

Details for d1gzwb_

PDB Entry: 1gzw, 1.7 Å

PDB Description: x-ray crystal structure of human galectin-1

PDB Compounds: (B:) galectin-1

SCOP Domain Sequences for d1gzwb_:

Sequence; same for both SEQRES and ATOM records:

>d1gzwb_ b.29.1.3 (B:) Galectin-1 {Human (Homo sapiens) [TaxId: 9606]}
acglvasnlnlkpgeclrvrgevapdaksfvlnlgkdsnnlclhfnprfnahgdantivc
nskdggawgteqreavfpfqpgsvaevcitfdqanltvklpdgyefkfpnrlnleainym
aadgdfkikcvafd

Timeline for d1gzwb_:

• d1gzwb_ first appeared in SCOP 1.67
  
• d1gzwb_ appears in SCOP 1.71
  
• d1gzwb_ appears in SCOP 1.75
  
• d1gzwb_ appears in the current release, SCOPe 2.08