Lineage for d1gxfa1 (1gxf A:4-169,A:287-357)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1832628Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1832629Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1833154Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 1833443Protein Trypanothione reductase [51947] (3 species)
  7. 1833478Species Trypanosoma cruzi [TaxId:5693] [51949] (4 PDB entries)
  8. 1833487Domain d1gxfa1: 1gxf A:4-169,A:287-357 [90527]
    Other proteins in same PDB: d1gxfa3, d1gxfb3
    complexed with fad, mae, qum

Details for d1gxfa1

PDB Entry: 1gxf (more details), 2.7 Å

PDB Description: crystal structure of trypanosoma cruzi trypanothione reductase in complex with the inhibitor quinacrine mustard
PDB Compounds: (A:) trypanothione reductase (oxidized form)

SCOPe Domain Sequences for d1gxfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gxfa1 c.3.1.5 (A:4-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]}
kifdlvvigagsggleaawnaatlykkrvavidvqmvhgppffsalggtcvnvgcvpkkl
mvtgaqymehlresagfgwefdrttlraewknliavkdeavlninksydemfrdteglef
flgwgslesknvvnvresadpasavkerletehillasgswphmpnXgrsprtkdlqlqn
agvmiknggvqvdeysrtnvsniyaigdvtnrvmltpvaineaaalvdtvfgttprkt

SCOPe Domain Coordinates for d1gxfa1:

Click to download the PDB-style file with coordinates for d1gxfa1.
(The format of our PDB-style files is described here.)

Timeline for d1gxfa1: